PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_11068-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 217aa    MW: 24477.2 Da    PI: 9.5072
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_11068-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.46.6e-184488147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg++T +Ed+l+v+++ +lG++ W++Ia++++ gRt++++k++w+++
  TRIUR3_11068-P1 44 RGNFTRDEDDLIVKLHSLLGNK-WSLIAARLP-GRTDNEIKNYWNTH 88
                     89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-4528IPR009057Homeodomain-like
PROSITE profilePS500905.03934IPR017877Myb-like domain
SuperFamilySSF466893.29E-212894IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-82950IPR009057Homeodomain-like
PROSITE profilePS5129428.153993IPR017930Myb domain
SMARTSM007178.6E-174391IPR001005SANT/Myb domain
PfamPF002493.3E-164488IPR001005SANT/Myb domain
CDDcd001671.00E-124689No hitNo description
Gene3DG3DSA:1.10.10.602.2E-235190IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTRE EDERLVAHSC RLRWINYLRP DLKRGNFTRD EDDLIVKLHS  60
LLGNKWSLIA ARLPGRTDNE IKNYWNTHIR RKLLGRGIDP VTHRPLTHAA SATTVSFLHP  120
AEPPKTQPAT EESKPPRCPD LNLDLCISLP FQQEEERPPA RACAKPVKME QLQQGGGGLC  180
FRCSILRVRG AATECSCGSN FLGLRAGMLD FRGLRMK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-22139326128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3584050.0AK358405.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1075P05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015695776.16e-98PREDICTED: myb-related protein Zm38-like
SwissprotP200256e-91MYB38_MAIZE; Myb-related protein Zm38
TrEMBLM7ZPI11e-161M7ZPI1_TRIUA; Myb-related protein Zm38
STRINGBGIOSGA026527-PA1e-96(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.11e-70myb domain protein 4